Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against THBS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human THBS1 (NP_003237.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against THBS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human THBS1 (NP_003237.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using THBS1 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-04219A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | THBS1 |
| Target Synonyms | TSP; THBS; TSP1; TSP-1; THBS-1; THBS1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human THBS1 (NP_003237.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS | Uniprot ID | P07996 |
Uniprot Id
P07996
Target Species
Human
Target Name
THBS1
Target Full Name
Thrombospondin-1
Target Function
Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp. Ligand for CD36 mediating antiangiogenic properties. Plays a role in ER stress response, via its interaction with the activating transcription factor 6 alpha (ATF6) which produces adaptive ER stress response factors.
Target Subcellular Location
Secreted. Cell surface. Secreted, extracellular space, extracellular matrix. Endoplasmic reticulum. Sarcoplasmic reticulum.
Target Protein Families
Thrombospondin family
Target Research Area
Cell Adhesion
Target Synonyms
THBS 1; THBS; Thbs1; Thrombospondin 1; Thrombospondin-1; TSP 1; TSP; TSP1; TSP1_HUMAN
Target Background
The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
