-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against THOC6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human THOC6 (NP_077315.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against THOC6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human THOC6 (NP_077315.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07083A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | THOC6 |
| Target Synonyms | WDR58; fSAP35; MMRFCGU; THOC6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, LO2, Mouse ovary, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human THOC6 (NP_077315.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IFSLSSALSSEAKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENSLILAGGDCQL | Uniprot ID | Q86W42 |
Uniprot Id
Q86W42
Target Species
Human
Target Name
THOC6
Target Full Name
THO complex subunit 6
Target Function
Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Plays a role in apoptosis negative control involved in brain development.
Target Involvement
Beaulieu-Boycott-Innes syndrome (BBIS)
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Protein Families
WD repeat THOC6 family
Target Synonyms
THOC6; WDR58; PSEC0006; THO complex subunit 6 homolog; Functional spliceosome-associated protein 35; fSAP35; WD repeat-containing protein 58
Target Background
This gene encodes a subunit of the multi-protein THO complex, which is involved in coordination between transcription and mRNA processing. The THO complex is a component of the TREX (transcription/export) complex, which is involved in transcription and export of mRNAs. A missense mutation in this gene is associated with a neurodevelopmental disorder called Beaulieu-Boycott-Innes syndrome.
Notification