Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMM17A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 72-171 of human TIMM17A(NP_006326.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIMM17A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 72-171 of human TIMM17A(NP_006326.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Mouse heart, using TIMM17A Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 30s.
| Cat.No | ADA-08161A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMM17A |
| Target Synonyms | TIM17; TIM17A; TIMM17A | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 72-171 of human TIMM17A(NP_006326.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ | Uniprot ID | Q99595 |
Uniprot Id
Q99595
Target Species
Human
Target Name
TIMM17A
Target Full Name
Mitochondrial import inner membrane translocase subunit Tim17-A
Target Function
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Tim17/Tim22/Tim23 family
Target Research Area
Signal Transduction
Target Synonyms
Inner membrane preprotein translocase Tim17a; Mitochondrial import inner membrane translocase subunit Tim17-A; mitochondrial inner membrane translocase; preprotein translocase; TI17A_HUMAN; TIM17; TIM17A; TIMM17A; translocase of inner mitochondrial membrane 17 homolog A (yeast)
Target Background
Predicted to contribute to protein transmembrane transporter activity. Predicted to be involved in protein import into mitochondrial matrix. Located in mitochondrial inner membrane and nucleoplasm. Is integral component of mitochondrial inner membrane. Part of TIM23 mitochondrial import inner membrane translocase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
