Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TKT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human TKT (NP_001055.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TKT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human TKT (NP_001055.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of various lysates, using TKT Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-06181A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TKT |
| Target Synonyms | TK; TKT1; SDDHD; HEL107; HEL-S-48; TKT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Hep G2, Mouse thymus, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human TKT (NP_001055.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEI | Uniprot ID | P29401 |
Uniprot Id
P29401
Target Species
Human
Target Name
TKT
Target Full Name
Transketolase
Target Function
Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.
Target Involvement
Short stature, developmental delay, and congenital heart defects (SDDHD)
Target Protein Families
Transketolase family
Target Research Area
Cardiovascular
Target Synonyms
EC 2.2.1.1; FLJ34765; TK; TKT 1; tkt; TKT_HUMAN; TKT1; Transketolase (Wernicke Korsakoff syndrome); Transketolase
Target Background
This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
