Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TM6SF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-377 of human TM6SF2 (NP_001001524.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TM6SF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-377 of human TM6SF2 (NP_001001524.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06206A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TM6SF2 |
| Form | Liquid | Species Reactivity | Human, Mouse |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | HT-29, Mouse lung |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-377 of human TM6SF2 (NP_001001524.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVPEDTWGCFFVCNLLYALGPHLLAYRCLQWPAFFHQPPPSDPLALHKKQH | Uniprot ID | Q9BZW4 |
Uniprot Id
Q9BZW4
Target Species
Human
Target Name
TM6SF2
Target Full Name
Transmembrane 6 superfamily member 2
Target Function
Regulator of liver fat metabolism influencing triglyceride secretion and hepatic lipid droplet content. May function as sterol isomerase.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.
Target Protein Families
TM6SF family
Target Tissue Specificity
Substantial expression in liver and intestine, whereas all other tissues analyzed show low levels.
Target Synonyms
TM6S2_HUMAN; Tm6sf2; Transmembrane 6 superfamily member 2
Target Background
Enables identical protein binding activity. Involved in regulation of lipid metabolic process. Located in endoplasmic reticulum membrane and endoplasmic reticulum-Golgi intermediate compartment membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
