Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM132D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 730-915 of human TMEM132D (NP_597705.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM132D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 730-915 of human TMEM132D (NP_597705.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04593A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM132D |
| Target Synonyms | TMEM132D; MOLT; PPP1R153 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 730-915 of human TMEM132D (NP_597705.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFSLMATSLDEKVVSIHQDPKFKWPIIAAETEGQGTLVKVEMVISESCQKSKRKSVLAVGTANIKVKFGQNDANPNTSDSRHTGAGVHMENNVSDRRPKKPSQEWGSQEGQYYGSSSMGLMEGRGTTTDRSILQKKKGQESLLDDNSHLQTIPSDLTSFPAQVDLPRSNGEMDGNDLMQASKGLSD | Uniprot ID | Q14C87 |
Uniprot Id
Q14C87
Target Species
Human
Target Name
TMEM132D
Target Full Name
Transmembrane protein 132D
Target Function
May serve as a cell-surface marker for oligodendrocyte differentiation.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
TMEM132 family
Target Tissue Specificity
Expressed in mature oligodendrocytes. Detected in the brain, lung, pancreas and testis.
Target Synonyms
TMEM132D; HBE120; KIAA1944; MOLT; Transmembrane protein 132D; Mature oligodendrocytes transmembrane protein; Mature OL transmembrane protein
Target Background
May serve as a cell-surface marker for oligodendrocyte differentiation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
