Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM74 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human TMEM74 (NP_694560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM74 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human TMEM74 (NP_694560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01465A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM74 |
| Target Synonyms | NET36; TMEM74 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human TMEM74 (NP_694560.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFIS | Uniprot ID | Q96NL1 |
Uniprot Id
Q96NL1
Target Species
Human
Target Name
TMEM74
Target Full Name
Transmembrane protein 74
Target Function
Plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.
Target Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein.
Target Protein Families
TMEM74 family
Target Tissue Specificity
Expressed in heart, lung, and placenta.
Target Synonyms
TMEM74; Transmembrane protein 74
Target Background
Involved in macroautophagy. Predicted to be located in autophagosome membrane; cytoplasmic vesicle; and lysosomal membrane. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
