Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOMM7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-55 of human TOMM7 (NP_061932.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOMM7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-55 of human TOMM7 (NP_061932.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11553A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOMM7 |
| Target Synonyms | TOM7; TOMM7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-55 of human TOMM7 (NP_061932.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG | Uniprot ID | Q9P0U1 |
Uniprot Id
Q9P0U1
Target Species
Human
Target Name
TOMM7
Target Full Name
Mitochondrial import receptor subunit TOM7 homolog
Target Function
Required for assembly and stability of the TOM complex. Positive regulator of PRKN translocation to damaged mitochondria. Acts probably by stabilizing PINK1 on the outer membrane of depolarized mitochondria.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Target Protein Families
Tom7 family
Target Synonyms
6.2 kd protein; Mitochondrial import receptor subunit TOM7 homolog; TOM7; TOM7_HUMAN; TOMM7; Translocase of outer membrane 7 kDa subunit homolog; Translocase of outer mitochondrial membrane 7 homolog (yeast)
Target Background
This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
