-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 580-680 of human TRAP1 (NP_057376.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against TRAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 580-680 of human TRAP1 (NP_057376.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-15273A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAP1 |
| Target Synonyms | HSP75; HSP 75; HSP90L; TRAP-1; TRAP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116 | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 580-680 of human TRAP1 (NP_057376.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAA | Uniprot ID | Q12931 |
Uniprot Id
Q12931
Target Species
Human
Target Name
TRAP1
Target Full Name
Heat shock protein 75 kDa, mitochondrial
Target Function
Chaperone that expresses an ATPase activity. Involved in maintaining mitochondrial function and polarization, downstream of PINK1 and mitochondrial complex I. Is a negative regulator of mitochondrial respiration able to modulate the balance between oxidative phosphorylation and aerobic glycolysis. The impact of TRAP1 on mitochondrial respiration is probably mediated by modulation of mitochondrial SRC and inhibition of SDHA.
Target Subcellular Location
Mitochondrion. Mitochondrion inner membrane. Mitochondrion matrix.
Target Protein Families
Heat shock protein 90 family
Target Tissue Specificity
Found in skeletal muscle, liver, heart, brain, kidney, pancreas, lung, placenta and bladder. Expression is highly reduced in bladder cancer and renal cell carcinoma specimens compared to healthy tissues, but it is increased in other type of tumors.
Target Research Area
Others
Target Synonyms
Heat shock protein 75 kDa; Heat shock protein 75 kDa, mitochondrial; HSP 75; HSP75; HSP90L; mitochondrial; TNF receptor associated protein 1; TNFR-associated protein 1; TRAP-1; Trap1; TRAP1_HUMAN; Tumor necrosis factor type 1 receptor-associated protein
Target Background
This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stress responses. Alternate splicing results in multiple transcript variants.
Notification