Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRHDE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-200 of human TRHDE (NP_037513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRHDE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-200 of human TRHDE (NP_037513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01401A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRHDE |
| Target Synonyms | PAP-II; PGPEP2; TRH-DE; TRHDE | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 62-200 of human TRHDE (NP_037513.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLRFDECGASATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAF | Uniprot ID | Q9UKU6 |
Uniprot Id
Q9UKU6
Target Species
Human
Target Name
TRHDE
Target Full Name
Thyrotropin-releasing hormone-degrading ectoenzyme
Target Function
Specific inactivation of TRH after its release.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase M1 family
Target Tissue Specificity
Predominantly expressed in brain.
Target Synonyms
TRHDE; UNQ2507/PRO5995; Thyrotropin-releasing hormone-degrading ectoenzyme; TRH-DE; TRH-degrading ectoenzyme; EC 3.4.19.6; Pyroglutamyl-peptidase II; PAP-II; TRH-specific aminopeptidase; Thyroliberinase
Target Background
This gene encodes a member of the peptidase M1 family. The encoded protein is an extracellular peptidase that specifically cleaves and inactivates the neuropeptide thyrotropin-releasing hormone.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
