-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-477 of human TRIM17 (NP_057186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-477 of human TRIM17 (NP_057186.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04799A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM17 |
| Target Synonyms | RBCC; terf; RNF16; TRIM17 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 280-477 of human TRIM17 (NP_057186.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VCRVPGQIEVLRGFLEDVVPDATSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRFVAYPCAVGQTAFSSGRHYWEVGMNITGDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG | Uniprot ID | Q9Y577 |
Uniprot Id
Q9Y577
Target Species
Human
Target Name
TRIM17
Target Full Name
E3 ubiquitin-protein ligase TRIM17
Target Function
E3 ubiquitin ligase that plays important roles in the regulation of neuronal apoptosis, selective autophagy or cell proliferation. Stimulates the degradation of kinetochore ZW10 interacting protein ZWINT in a proteasome-dependent manner, leading to negative regulation of cell proliferation. Inhibits autophagic degradation of diverse known targets while contributing to autophagy of midbodies. Autophagy-inhibitory activity involves MCL1, which TRIM17 assembles into complexes with the key autophagy regulator BECN1. Controls neuronal apoptosis by mediating ubiquitination and degradation of MCL1 to initiate neuronal death. In addition, regulates NFAT transcription factors NFATC3 and NFATC4 activities by preventing their nuclear localization, thus inhibiting their transcriptional activities. Decreases TRIM41-mediated degradation of ZSCAN2 thereby stimulating alpha-synuclein/SNCA transcription in neuronal cells. Prevents the E3 ubiquitin-ligase activity of TRIM28 and its interaction with anti-apoptotic BCL2A1, blocking TRIM28 from ubiquitinating BCL2A1.
Target Subcellular Location
Cytoplasm. Lysosome.
Target Protein Families
TRIM/RBCC family
Target Tissue Specificity
Almost exclusively in the testis.
Target Synonyms
E3 ubiquitin-protein ligase TRIM17; RBCC; RING finger protein 16; RING finger protein terf; RNF16; TERF; Testis RING finger protein; TRI17_HUMAN; TRIM 17; Trim17; Tripartite motif containing 17; Tripartite motif containing protein 17; Tripartite motif protein 17; Tripartite motif-containing protein 17
Target Background
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene.
Notification