-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRIM24 (O15164) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRIM24 (O15164) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13393A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM24 |
| Target Synonyms | PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA; TRIM24 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRIM24 (O15164). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQG | Uniprot ID | O15164 |
Uniprot Id
O15164
Target Species
Human
Target Name
TRIM24
Target Full Name
Transcription intermediary factor 1-alpha
Target Function
Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes.
Target Involvement
A chromosomal aberration involving TRIM24/TIF1 is found in papillary thyroid carcinomas (PTCs). Translocation t(7;10)(q32;q11) with RET. The translocation generates the TRIM24/RET (PTC6) oncogene.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Colocalizes with sites of active transcription. Detected both in nucleus and cytoplasm in some breast cancer samples. Predominantly nuclear.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
E3 ubiquitin protein ligase TRIM24; E3 ubiquitin-protein ligase Trim24; hTIF1; PTC6; RING finger protein 82; RNF82; TF1A; TIF1 alpha; TIF1; TIF1-alpha; TIF1A; TIF1A_HUMAN; TIF1ALPHA; Transcription intermediary factor 1-alpha; Transcriptional intermediary factor 1 alpha; Transcriptional intermediary factor 1; Trim24; Tripartite motif containing 24; Tripartite motif-containing protein 24
Target Background
The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification