-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human TRPC5 (NP_036603.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TRPC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human TRPC5 (NP_036603.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01255A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPC5 |
| Target Synonyms | TRP5; PPP1R159; TRPC5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Neuro-2a, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human TRPC5 (NP_036603.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN | Uniprot ID | Q9UL62 |
Uniprot Id
Q9UL62
Target Species
Human
Target Name
TRPC5
Target Full Name
Short transient receptor potential channel 5
Target Function
Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Has also been shown to be calcium-selective. May also be activated by intracellular calcium store depletion. Mediates calcium-dependent phosphatidylserine externalization and apoptosis in neurons via its association with PLSCR1.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Transient receptor (TC 1.A.4) family, STrpC subfamily, TRPC5 sub-subfamily
Target Tissue Specificity
Expressed in brain with higher levels in fetal brain. Found in cerebellum and occipital pole.
Target Synonyms
Htrp 5; Htrp-5; Htrp5; Short transient receptor potential channel 5; Transient receptor potential cation channel subfamily C member 5; Transient receptor potential channel 5; Transient receptor protein 5; TRP 5; TRP-5; TRP5; TRPC 5; TrpC5; TRPC5_HUMAN
Target Background
This gene belongs to the transient receptor family. It encodes one of the seven mammalian TRPC (transient receptor potential channel) proteins. The encoded protein is a multi-pass membrane protein and is thought to form a receptor-activated non-selective calcium permeant cation channel. The protein is active alone or as a heteromultimeric assembly with TRPC1, TRPC3, and TRPC4. It also interacts with multiple proteins including calmodulin, CABP1, enkurin, Na(+)-H+ exchange regulatory factor (NHERF ), interferon-induced GTP-binding protein (MX1), ring finger protein 24 (RNF24), and SEC14 domain and spectrin repeat-containing protein 1 (SESTD1).
Notification