-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1460-1540 of human TRPM1 (NP_002411.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1460-1540 of human TRPM1 (NP_002411.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06902A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPM1 |
| Target Synonyms | MLSN1; CSNB1C; LTRPC1; TRPM1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SK-MEL-28 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1460-1540 of human TRPM1 (NP_002411.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPD | Uniprot ID | Q7Z4N2 |
Uniprot Id
Q7Z4N2
Target Species
Human
Target Name
TRPM1
Target Full Name
Transient receptor potential cation channel subfamily M member 1
Target Function
Forms nonselective divalent cation-conducting channels which mediate the influx of Na(2+), Ca(2+), Mg(2+), Mn(2+), Ba(2+), and Ni(2+) into the cytoplasm, leading to membrane depolarization. Impermeable to zinc ions. In addition, forms heteromultimeric ion channels with TRPM3 which are permeable for calcium and zinc ions. Essential for the depolarizing photoresponse of retinal ON bipolar cells. It is part of the GRM6 signaling cascade. May play a role in metastasis suppression. May act as a spontaneously active, calcium-permeable plasma membrane channel.
Target Involvement
Night blindness, congenital stationary, 1C (CSNB1C)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, axon.
Target Protein Families
Transient receptor (TC 1.A.4) family, LTrpC subfamily, TRPM1 sub-subfamily
Target Tissue Specificity
Expressed in the retina where it localizes to the outer plexiform layer. Specifically, it is expressed in retinal bipolar cells (BPCs) of the ON subtype. Highly expressed in benign melanocytic nevi and diffusely expressed in various in situ melanomas, but
Target Research Area
Signal Transduction
Target Synonyms
CSNB1C; Long transient receptor potential channel 1; LTrpC1; Melastatin 1; Melastatin-1; MLSN1; Transient receptor potential cation channel subfamily M member 1; Transient receptor potential cation channel, subfamily M, member 1; Transient receptor potential melastatin family; TRPM1; TRPM1 protein; TRPM1_HUMAN; Weakly similar to F54D1.5 [C.elegans]
Target Background
This gene encodes a member of the transient receptor potential melastatin subfamily of transient receptor potential ion channels. The encoded protein is a calcium permeable cation channel that is expressed in melanocytes and may play a role in melanin synthesis. Specific mutations in this gene are the cause autosomal recessive complete congenital stationary night blindness-1C. The expression of this protein is inversely correlated with melanoma aggressiveness and as such it is used as a prognostic marker for melanoma metastasis. Alternate splicing results in multiple transcript variants.
Notification