-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPV4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-871 of human TRPV4 (NP_067638.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPV4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-871 of human TRPV4 (NP_067638.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10799A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPV4 |
| Target Synonyms | SMAL; VRL2; BCYM3; CMT2C; SPSMA; TRP12; VROAC; HMSN2C; OTRPC4; SSQTL1; TRPV4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-375 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-871 of human TRPV4 (NP_067638.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDEVVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL | Uniprot ID | Q9HBA0 |
Uniprot Id
Q9HBA0
Target Species
Human
Target Name
TRPV4
Target Full Name
Transient receptor potential cation channel subfamily V member 4
Target Function
Non-selective calcium permeant cation channel involved in osmotic sensitivity and mechanosensitivity. Activation by exposure to hypotonicity within the physiological range exhibits an outward rectification. Also activated by heat, low pH, citrate and phorbol esters. Increase of intracellular Ca(2+) potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism. Promotes cell-cell junction formation in skin keratinocytes and plays an important role in the formation and/or maintenance of functional intercellular barriers. Acts as a regulator of intracellular Ca(2+) in synoviocytes. Plays an obligatory role as a molecular component in the nonselective cation channel activation induced by 4-alpha-phorbol 12,13-didecanoate and hypotonic stimulation in synoviocytes and also regulates production of IL-8. Together with PKD2, forms mechano- and thermosensitive channels in cilium. Negatively regulates expression of PPARGC1A, UCP1, oxidative metabolism and respiration in adipocytes. Regulates expression of chemokines and cytokines related to proinflammatory pathway in adipocytes. Together with AQP5, controls regulatory volume decrease in salivary epithelial cells. Required for normal development and maintenance of bone and cartilage. In its inactive state, may sequester DDX3X at the plasma membrane. When activated, the interaction between both proteins is affected and DDX3X relocalizes to the nucleus.; Non-selective calcium permeant cation channel involved in osmotic sensitivity and mechanosensitivity. Activation by exposure to hypotonicity within the physiological range exhibits an outward rectification. Also activated by phorbol esters. Has the same channel activity as isoform 1, and is activated by the same stimuli.; Lacks channel activity, due to impaired oligomerization and intracellular retention.; Lacks channel activity, due to impaired oligomerization and intracellular retention.; Lacks channel activity, due to impaired oligomerization and intracellular retention.; (Microbial infection) Facilitates hepatitis C virus (HCV) replication, possibly through its action on DDX3X.; (Microbial infection) Facilitates Dengue virus (DENV) replication, possibly through its action on DDX3X.; (Microbial infection) Facilitates Zika virus (ZIKV) replication, possibly through its action on DDX3X.
Target Involvement
Brachyolmia 3 (BCYM3); Spondylometaphyseal dysplasia Kozlowski type (SMDK); Metatropic dysplasia (MTD); Neuronopathy, distal hereditary motor, 8 (HMN8); Charcot-Marie-Tooth disease 2C (CMT2C); Scapuloperoneal spinal muscular atrophy (SPSMA); Spondyloepiphyseal dysplasia Maroteaux type (SEDM); Parastremmatic dwarfism (PSTD); Digital arthropathy-brachydactyly, familial (FDAB); Avascular necrosis of the femoral head, primary 2 (ANFH2)
Target Subcellular Location
Cell membrane. Apical cell membrane; Multi-pass membrane protein. Cell junction, adherens junction. Cell projection, cilium.; [Isoform 1]: Cell membrane.; [Isoform 5]: Cell membrane.; [Isoform 2]: Endoplasmic reticulum.; [Isoform 4]: Endoplasmic reticulum.; [Isoform 6]: Endoplasmic reticulum.
Target Protein Families
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV4 sub-subfamily
Target Tissue Specificity
Found in the synoviocytes from patients with (RA) and without (CTR) rheumatoid arthritis (at protein level).
Target Synonyms
BCYM3; CMT2C; HMSN2C; osm 9 like TRP channel 4; Osm-9-like TRP channel 4; OSM9 like transient receptor potential channel 4; Osmosensitive transient receptor potential channel 4; OTRPC 4; OTRPC4; SMAL; SPSMA; SSQTL1; Transient receptor potential cation channel subfamily V member 4; Transient receptor potential protein 12; TRP 12; TRP12; TRPV 4; TrpV4; TRPV4_HUMAN; Vanilloid receptor like channel 2 ; Vanilloid receptor like protein 2; Vanilloid receptor related osmotically activated channel; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR 4; VR OAC; VR-OAC; VR4; VRL 2; VRL-2; VRL2; VROAC
Target Background
This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification