Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRUB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human TRUB1 (NP_631908.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRUB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human TRUB1 (NP_631908.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07465A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRUB1 |
| Target Synonyms | PUS4; TRUB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, Mouse liver, Mouse skeletal muscle, Rat liver, RD | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human TRUB1 (NP_631908.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGGFYIRSLVSDIGKELSSCANVLELTRTKQ | Uniprot ID | Q8WWH5 |
Uniprot Id
Q8WWH5
Target Species
Human
Target Name
TRUB1
Target Full Name
Pseudouridylate synthase TRUB1
Target Function
Pseudouridine synthase that catalyzes pseudouridylation of mRNAs. Mediates pseudouridylation of mRNAs with the consensus sequence 5'-GUUCNANNC-3', harboring a stem-loop structure. Constitutes the major pseudouridine synthase acting on mRNAs.
Target Subcellular Location
Nucleus. Cytoplasm, cytosol.
Target Protein Families
Pseudouridine synthase TruB family
Target Tissue Specificity
Highly expressed in heart, skeletal muscle and liver. Expressed at lower levels in lung, small intestine, kidney and spleen.
Target Synonyms
Probable tRNA pseudouridine synthase 1; PUS4; TruB pseudouridine (psi) synthase homolog 1 (E. coli); Trub1; TRUB1_HUMAN
Target Background
Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
