Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSFM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 245-346 of human TSFM (NP_001166167.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TSFM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 245-346 of human TSFM (NP_001166167.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00561A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSFM |
| Target Synonyms | EFTS; EFTSMT; TSFM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, HepG2, Jurkat, Mouse liver, Rat liver, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 245-346 of human TSFM (NP_001166167.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE | Uniprot ID | P43897 |
Uniprot Id
P43897
Target Species
Human
Target Name
TSFM
Target Full Name
Elongation factor Ts, mitochondrial
Target Function
Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.
Target Involvement
Combined oxidative phosphorylation deficiency 3 (COXPD3)
Target Subcellular Location
Mitochondrion.
Target Protein Families
EF-Ts family
Target Tissue Specificity
Expressed in all tissues, with the highest levels of expression in skeletal muscle, liver and kidney.
Target Synonyms
COXPD 3; COXPD3; EF TS; EF Tsmt; EF-Ts; EF-TsMt; EFTS; EFTS_HUMAN; EFTSMT; Elongation factor Ts; Elongation factor Ts mitochondrial; HGNC12367; mitochondrial; Mitochondrial elongation factor Ts; Ts translation elongation factor mitochondrial; TSFM; TSMT
Target Background
This gene encodes a mitochondrial translation elongation factor. The encoded protein is an enzyme that catalyzes the exchange of guanine nucleotides on the translation elongation factor Tu during the elongation step of mitchondrial protein translation. Mutations in this gene are associated with combined oxidative phosphorylation deficiency-3 syndrome. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
