Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TXNDC12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-172 of human TXNDC12 (NP_056997.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TXNDC12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-172 of human TXNDC12 (NP_056997.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10211A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TXNDC12 |
| Target Synonyms | AG1; AGR1; ERP16; ERP18; ERP19; TLP19; hAG-1; PDIA16; hTLP19; TXNDC12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, HepG2, Mouse brain, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 93-172 of human TXNDC12 (NP_056997.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL | Uniprot ID | O95881 |
Uniprot Id
O95881
Target Species
Human
Target Name
TXNDC12
Target Full Name
Thioredoxin domain-containing protein 12
Target Function
Possesses significant protein thiol-disulfide oxidase activity.
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Tissue Specificity
Widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
AG1; AGR1; anterior gradient homolog 1; endoplasmic reticulum protein ERp19; Endoplasmic reticulum resident protein 18; Endoplasmic reticulum resident protein 19; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; ER protein 18; ER protein 19; ERP 18; ERP16; ERp18; ERp19; hAG 1; hAG1; hTLP19; PDIA16; protein disulfide isomerase family A, member 16; thioredoxin domain containing 12 (endoplasmic reticulum; Thioredoxin domain-containing protein 12; thioredoxin like protein p19; Thioredoxin-like protein p19; TLP19; TXD12_HUMAN; TXNDC12
Target Background
This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
