Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 53-152 of human UBE2B (P63146) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UBE2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 53-152 of human UBE2B (P63146) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14466A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2B |
| Target Synonyms | HR6B; UBC2; HHR6B; RAD6B; E2-17kDa; UBE2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, NIH/3T3, 293T, K-562, Mouse testis, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 53-152 of human UBE2B (P63146). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS | Uniprot ID | P63146 |
Uniprot Id
P63146
Target Species
Human
Target Name
UBE2B
Target Full Name
Ubiquitin-conjugating enzyme E2 B
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'- and 'Lys-63'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA. Associates to the E3 ligase RAD18 to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. May be involved in neurite outgrowth.
Target Subcellular Location
Cell membrane. Nucleus.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Synonyms
E2 17kDa; E2 protein; hHR6B; HR6B; RAD6 homolog B; RAD6B; UBC2; UBE2B; UBE2B_HUMAN; Ubiquitin carrier protein B; Ubiquitin conjugating enzyme E2 B; Ubiquitin conjugating enzyme E2B (RAD6 homolog); Ubiquitin conjugating enzyme E2B; Ubiquitin protein ligase B; Ubiquitin-conjugating enzyme E2 17 kDa; Ubiquitin-conjugating enzyme E2 B; Ubiquitin-conjugating enzyme E2-17 kDa; Ubiquitin-protein ligase B
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
