-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2V2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human UBE2V2 (NP_003341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UBE2V2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human UBE2V2 (NP_003341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02752A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2V2 |
| Target Synonyms | MMS2; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1; UBE2V2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HL-60, Mouse liver, Mouse skin, Rat liver, SKOV3, SW480 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human UBE2V2 (NP_003341.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN | Uniprot ID | Q15819 |
Uniprot Id
Q15819
Target Species
Human
Target Name
UBE2V2
Target Full Name
Ubiquitin-conjugating enzyme E2 variant 2
Target Function
Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
1 alpha 25 dihydroxyvitamin D3 inducible; DDVit 1; DDVIT1; EDAF-1; EDAF1; EDPF-1; EDPF1; Enterocyte differentiation associated factor EDAF 1; Enterocyte differentiation promoting factor; Enterocyte differentiation-associated factor 1; Enterocyte differentiation-promoting factor 1; Methyl methanesulfonate sensitive 2; MMS 2; MMS2; MMS2 homolog; UB2V2_HUMAN; UBE2V 2; UBE2V2; Ubiquitin conjugating enzyme E2 variant 2; Ubiquitin conjugating enzyme E2v2; Ubiquitin-conjugating enzyme E2 variant 2; UEV 2; UEV2; Vitamin D3 inducible protein; Vitamin D3-inducible protein
Target Background
Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes.
Notification