-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2W was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-110 of human UBE2W (NP_001001481.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2W was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-110 of human UBE2W (NP_001001481.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01772A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2W |
| Target Synonyms | UBC16; UBC-16; UBE2W | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, LO2, MCF7, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-110 of human UBE2W (NP_001001481.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEVWFPKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ | Uniprot ID | Q96B02 |
Uniprot Id
Q96B02
Target Species
Human
Target Name
UBE2W
Target Full Name
Ubiquitin-conjugating enzyme E2 W
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini. Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3. After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. In vitro catalyzes 'Lys-11'-linked polyubiquitination. UBE2W-catalyzed ubiquitination occurs also in the presence of inactive RING/U-box type E3s, i.e. lacking the active site cysteine residues to form thioester bonds with ubiquitin, or even in the absence of E3, albeit at a slower rate.
Target Subcellular Location
Nucleus.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Widely expressed, with highest expression in brain, liver, pancreas and heart.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
FLJ11011; hUBC 16; hUBC16; Probable ubiquitin conjugating enzyme E2 W; Probable ubiquitin-conjugating enzyme E2 W; UBC 16; UBC-16; UBC16; UBE 2W; ube2w; UBE2W_HUMAN; Ubiquitin carrier protein W; Ubiquitin conjugating enzyme 16; Ubiquitin conjugating enzyme E2 W; Ubiquitin conjugating enzyme E2W; Ubiquitin protein ligase W; Ubiquitin-protein ligase W
Target Background
This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
Notification