Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UGGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1456-1555 of human UGGT1 (NP_064505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UGGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1456-1555 of human UGGT1 (NP_064505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03887A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UGGT1 |
| Target Synonyms | UGT1; HUGT1; UGCGL1; UGGT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, HepG2, HL-60, HT-1080, Mouse liver, Rat liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1456-1555 of human UGGT1 (NP_064505.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL | Uniprot ID | Q9NYU2 |
Uniprot Id
Q9NYU2
Target Species
Human
Target Name
UGGT1
Target Full Name
UDP-glucose:glycoprotein glucosyltransferase 1
Target Function
Recognizes glycoproteins with minor folding defects. Reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.
Target Subcellular Location
Endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment.
Target Protein Families
Glycosyltransferase 8 family
Target Tissue Specificity
Higher levels in pancreas, skeletal muscle, kidney, and brain. Low levels in lung and heart.
Target Synonyms
GT; HUGT1; UDP glucose glycoprotein glucosyltransferase 1; UDP Glucose Glycoprotein Glucosyltransferase; UDP--Glc:glycoprotein glucosyltransferase; UDP-glucose ceramide glucosyltransferase-like 1; UDP-glucose:glycoprotein glucosyltransferase 1; UGCGL1; UGGG1; UGGG1_HUMAN; UGGT; Uggt1; UGT1; UGTR
Target Background
UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
