Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UPP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 89-173 of human UPP1 (NP_001274357.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UPP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 89-173 of human UPP1 (NP_001274357.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03397A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UPP1 |
| Target Synonyms | UP; UPP; UPASE; UDRPASE; UPP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-431, A-549, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 89-173 of human UPP1 (NP_001274357.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA | Uniprot ID | Q16831 |
Uniprot Id
Q16831
Target Species
Human
Target Name
UPP1
Target Full Name
Uridine phosphorylase 1
Target Function
Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Target Protein Families
PNP/UDP phosphorylase family
Target Synonyms
UDRPASE; UP; UPase 1; UPASE; UPP; Upp1; UPP1_HUMAN; UrdPase 1; Uridine phosphorylase 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
