-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-700 of human USP4 (NP_003354.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-700 of human USP4 (NP_003354.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13738A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP4 |
| Target Synonyms | UNP; Unph; P4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 560-700 of human USP4 (NP_003354.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ | Uniprot ID | Q13107 |
Uniprot Id
Q13107
Target Species
Human
Target Name
USP4
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 4
Target Function
Deubiquitinating enzyme that removes conjugated ubiquitin from target proteins. Deubiquitinates PDPK1. Deubiquitinates TRIM21. Deubiquitinates receptor ADORA2A which increases the amount of functional receptor at the cell surface. May regulate mRNA splicing through deubiquitination of the U4 spliceosomal protein PRPF3. This may prevent its recognition by the U5 component PRPF8 thereby destabilizing interactions within the U4/U6.U5 snRNP. May also play a role in the regulation of quality control in the ER.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Peptidase C19 family, USP4 subfamily
Target Tissue Specificity
Overexpressed in small cell tumors and adenocarcinomas of the lung compared to wild-type lung (at protein level). Expressed in the hippocampal neurons.
Target Synonyms
Deubiquitinating enzyme 4; MGC149848; MGC149849; Proto oncogene; Protooncogene; Ubiquitin carboxyl terminal hydrolase 4; Ubiquitin carboxyl-terminal hydrolase 4; Ubiquitin specific peptidase 4 (proto oncogene); Ubiquitin specific peptidase 4 (protooncogene); Ubiquitin specific peptidase 4; Ubiquitin specific processing protease 4; Ubiquitin specific protease 4 (proto oncogene); Ubiquitin specific protease 4 (protooncogene); Ubiquitin specific protease 4; Ubiquitin specific protease proto oncogene; Ubiquitin specific protease protooncogene; Ubiquitin thioesterase 4; Ubiquitin thiolesterase 4; Ubiquitin-specific-processing protease 4; Ubiquitous nuclear protein homolog; UBP4_HUMAN; UNP; UNPH; USP 4; USP4
Target Background
The protein encoded by this gene is a protease that deubiquitinates target proteins such as ADORA2A and TRIM21. The encoded protein shuttles between the nucleus and cytoplasm and is involved in maintaining operational fidelity in the endoplasmic reticulum. Three transcript variants encoding different isoforms have been found for this gene.
Notification