Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UTS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 35-124 of human UTS2 (NP_006777.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UTS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 35-124 of human UTS2 (NP_006777.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03827A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UTS2 |
| Target Synonyms | UII; U-II; UCN2; PRO1068; UTS2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse skeletal muscle, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 35-124 of human UTS2 (NP_006777.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV | Uniprot ID | O95399 |
Uniprot Id
O95399
Target Species
Human
Target Name
UTS2
Target Full Name
Urotensin-2
Target Function
Highly potent vasoconstrictor.
Target Subcellular Location
Secreted.
Target Protein Families
Urotensin-2 family
Target Tissue Specificity
Brain specific.
Target Synonyms
PRO1068; U-II; UCN2; UII; Urotensin 2 preproprotein isoform a; Urotensin 2 preproprotein isoform b; Urotensin II; Urotensin-2; UTS2; UTS2_HUMAN; UTSII
Target Background
This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
