Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAMP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human VAMP5 (NP_006625.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VAMP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human VAMP5 (NP_006625.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05687A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAMP5 |
| Target Synonyms | VAMP5 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human VAMP5 (NP_006625.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN | Uniprot ID | O95183 |
Uniprot Id
O95183
Target Species
Human
Target Name
VAMP5
Target Full Name
Vesicle-associated membrane protein 5
Target Function
May participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
Target Subcellular Location
Cell membrane; Single-pass type IV membrane protein. Endomembrane system; Single-pass type IV membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein.
Target Protein Families
Synaptobrevin family
Target Synonyms
VAMP5; HSPC191; Vesicle-associated membrane protein 5; VAMP-5; Myobrevin
Target Background
Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
