Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VANGL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human VANGL2 (NP_065068.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against VANGL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human VANGL2 (NP_065068.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10973A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VANGL2 |
| Target Synonyms | LPP1; LTAP; STB1; STBM; STBM1; VANGL2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse brain, Mouse spinal cord, Mouse thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human VANGL2 (NP_065068.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTRGDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVA | Uniprot ID | Q9ULK5 |
Uniprot Id
Q9ULK5
Target Species
Human
Target Name
VANGL2
Target Full Name
Vang-like protein 2
Target Function
Involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. Plays a role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. Required for polarization and movement of myocardializing cells in the outflow tract and seems to act via RHOA signaling to regulate this process. Required for cell surface localization of FZD3 and FZD6 in the inner ear.
Target Involvement
Neural tube defects (NTD)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Vang family
Target Synonyms
VANGL2; KIAA1215; STB1; Vang-like protein 2; Loop-tail protein 1 homolog; Strabismus 1; Van Gogh-like protein 2
Target Background
The protein encoded by this gene is a membrane protein involved in the regulation of planar cell polarity, especially in the stereociliary bundles of the cochlea. The encoded protein transmits directional signals to individual cells or groups of cells in epithelial sheets. This protein is also involved in the development of the neural plate.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
