-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VEGFR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VEGFR1 (P17948) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VEGFR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VEGFR1 (P17948) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15980A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VEGFR1 |
| Target Synonyms | FLT; FLT-1; VEGFR1; VEGFR-1; FRT | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VEGFR1 (P17948). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN | Uniprot ID | P17948 |
Uniprot Id
P17948
Target Species
Human
Target Name
FLT1
Target Full Name
Vascular endothelial growth factor receptor 1
Target Function
Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFB and PGF, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. Acts as a positive regulator of postnatal retinal hyaloid vessel regression (Ref.11). May play an essential role as a negative regulator of embryonic angiogenesis by inhibiting excessive proliferation of endothelial cells. Can promote endothelial cell proliferation, survival and angiogenesis in adulthood. Its function in promoting cell proliferation seems to be cell-type specific. Promotes PGF-mediated proliferation of endothelial cells, proliferation of some types of cancer cells, but does not promote proliferation of normal fibroblasts (in vitro). Has very high affinity for VEGFA and relatively low protein kinase activity; may function as a negative regulator of VEGFA signaling by limiting the amount of free VEGFA and preventing its binding to KDR. Modulates KDR signaling by forming heterodimers with KDR. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate and the activation of protein kinase C. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leading to activation of phosphatidylinositol kinase and the downstream signaling pathway. Mediates activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Phosphorylates SRC and YES1, and may also phosphorylate CBL. Promotes phosphorylation of AKT1 at 'Ser-473'. Promotes phosphorylation of PTK2/FAK1.; Phosphorylates PLCG.; May function as decoy receptor for VEGFA.; May function as decoy receptor for VEGFA.; May function as decoy receptor for VEGFA.; Has a truncated kinase domain; it increases phosphorylation of SRC at 'Tyr-418' by unknown means and promotes tumor cell invasion.
Target Involvement
Can contribute to cancer cell survival, proliferation, migration, and invasion, and tumor angiogenesis and metastasis. May contribute to cancer pathogenesis by promoting inflammatory responses and recruitment of tumor-infiltrating macrophages.; DISEASE: Note=Abnormally high expression of soluble isoforms (isoform 2, isoform 3 or isoform 4) may be a cause of preeclampsia.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Endosome. Note=Autophosphorylation promotes ubiquitination and endocytosis.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 5]: Cytoplasm.; [Isoform 6]: Cytoplasm.; [Isoform 7]: Cytoplasm.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily
Target Tissue Specificity
Detected in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform 2 is strongly expressed in placenta. Isoform
Target Research Area
Cancer
Target Synonyms
EC 2.7.10.1; FLT 1; FLT; Flt-1; FLT1; Fms like tyrosine kinase 1; Fms related tyrosine kinase 1; Fms related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); Fms related tyrosine kinase 1 vascular endothelial growth factor/vascular permeability factor receptor; Fms-like tyrosine kinase 1; FRT; Soluble VEGF receptor 1 14; Soluble VEGFR1 variant 2; Soluble VEGFR1 variant 21; Tyrosine protein kinase FRT; Tyrosine protein kinase receptor FLT; Tyrosine-protein kinase FRT; Tyrosine-protein kinase receptor FLT; Vascular endothelial growth factor receptor 1; Vascular endothelial growth factor vascular permeability factor receptor; Vascular permeability factor receptor 1; Vascular permeability factor receptor; VEGFR 1; VEGFR-1; VEGFR1; VGFR1_HUMAN
Target Background
This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.
Notification