Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VGLL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VGLL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04795A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VGLL1 |
| Target Synonyms | TDU; VGL1; VGLL1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYLQHL | Uniprot ID | Q99990 |
Uniprot Id
Q99990
Target Species
Human
Target Name
VGLL1
Target Full Name
Transcription cofactor vestigial-like protein 1
Target Function
May act as a specific coactivator for the mammalian TEFs.
Target Subcellular Location
Nucleus.
Target Protein Families
Vestigial family
Target Synonyms
Protein TONDU; TDU; TONDU; Transcription cofactor vestigial like protein 1; Transcription cofactor vestigial-like protein 1; Vestigial like 1; vestigial like 1 homolog (Drosophila); Vgl-1; VGL1; Vgll1; VGLL1_HUMAN
Target Background
The protein encoded by this gene binds proteins of the TEA domain family of transcription factors (TEFs) through the Vg (vestigial) homology region found in its N-terminus. It may thus function as a specific coactivator for the mammalian TEFs.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
