-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Vimentin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 367-466 of human Vimentin (P08670) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Vimentin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 367-466 of human Vimentin (P08670) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-17163A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Vimentin |
| Target Synonyms | CTRCT30; HEL113; Vimentin; VIM; vimentin; in | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, 293T, Jurkat, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 367-466 of human Vimentin (P08670). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE | Uniprot ID | P08670 |
Uniprot Id
P08670
Target Species
Human
Target Name
VIM
Target Full Name
Vimentin
Target Function
Vimentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.; Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
Target Involvement
Cataract 30, multiple types (CTRCT30)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus matrix. Cell membrane.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Highly expressed in fibroblasts, some expression in T- and B-lymphocytes, and little or no expression in Burkitt's lymphoma cell lines. Expressed in many hormone-independent mammary carcinoma cell lines.
Target Research Area
Immunology, Cancer
Target Synonyms
CTRCT30; Epididymis luminal protein 113; FLJ36605; HEL113; VIM; VIME_HUMAN; Vimentin
Target Background
This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients.
Notification