-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VSX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human VSX1 (NP_055403.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VSX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human VSX1 (NP_055403.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00929A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VSX1 |
| Target Synonyms | PPD; KTCN; PPCD; RINX; KTCN1; PPCD1; CAASDS; VSX1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human VSX1 (NP_055403.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPGQGSGCEGPAVAPCPGPGLDGSSLARGALPLGLGLLCGFGTQPPAAARAPCLLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTV | Uniprot ID | Q9NZR4 |
Uniprot Id
Q9NZR4
Target Species
Human
Target Name
VSX1
Target Full Name
Visual system homeobox 1
Target Function
Binds to the 37-bp core of the locus control region (LCR) of the red/green visual pigment gene cluster. May regulate the activity of the LCR and the cone opsin genes at earlier stages of development. Dispensable in early retinal development.
Target Involvement
Keratoconus 1 (KTCN1); Craniofacial anomalies and anterior segment dysgenesis syndrome (CAASDS)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Tissue Specificity
In the adult eye, expressed in lens, iris, ciliary body, choroid, optical nerve head and, most strongly, in retina, but not expressed in sclera and cornea. According to PubMed:11978762, expressed in adult retina but not in lens and cornea. Within adult re
Target Synonyms
VSX1; RINX; Visual system homeobox 1; Homeodomain protein RINX; Retinal inner nuclear layer homeobox protein; Transcription factor VSX1
Target Background
The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification