-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against XPO7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human XPO7 (NP_055839.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against XPO7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human XPO7 (NP_055839.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04638A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | XPO7 |
| Target Synonyms | EXP7; RANBP16; XPO7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, LO2, Mouse liver, Mouse spleen, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human XPO7 (NP_055839.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMKNSTYGVNSNDMMS | Uniprot ID | Q9UIA9 |
Uniprot Id
Q9UIA9
Target Species
Human
Target Name
XPO7
Target Full Name
Exportin-7
Target Function
Mediates the nuclear export of proteins (cargos) with broad substrate specificity. In the nucleus binds cooperatively to its cargo and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. XPO7 then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Exportin family
Target Tissue Specificity
Strong expression in testis, thyroid and bone marrow, low expression in lung, liver and small intestine, no expression in thymus, and remaining tissues studied have moderate expression. Expressed in red blood cells; overexpressed in red blood cells (cytop
Target Synonyms
XPO7; KIAA0745; RANBP16; Exportin-7; Exp7; Ran-binding protein 16
Target Background
The transport of protein and large RNAs through the nuclear pore complexes (NPC) is an energy-dependent and regulated process. The import of proteins with a nuclear localization signal (NLS) is accomplished by recognition of one or more clusters of basic amino acids by the importin-alpha/beta complex; see MIM 600685 and MIM 602738. The small GTPase RAN (MIM 601179) plays a key role in NLS-dependent protein import. RAN-binding protein-16 is a member of the importin-beta superfamily of nuclear transport receptors.
Notification