Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ZP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12543A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZP2 |
| Target Synonyms | ZPA; Zp-2; OOMD6; OZEMA6; ZP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Mouse liver, Rat ovary, SH-SY5Y, SW620 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH | Uniprot ID | Q05996 |
Uniprot Id
Q05996
Target Species
Human
Target Name
ZP2
Target Full Name
Zona pellucida sperm-binding protein 2
Target Function
Component of the zona pellucida, an extracellular matrix surrounding oocytes which mediates sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. The zona pellucida is composed of 3 to 4 glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor.
Target Subcellular Location
[Processed zona pellucida sperm-binding protein 2]: Zona pellucida.; Cell membrane; Single-pass type I membrane protein.
Target Protein Families
ZP domain family, ZPA subfamily
Target Tissue Specificity
Expressed in occytes(at protein level).
Target Synonyms
ZPA; Zp-2; OOMD6; OZEMA6; ZP2
Target Background
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
