Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZSCAN21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-280 of human ZSCAN21 (NP_666019.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZSCAN21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-280 of human ZSCAN21 (NP_666019.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05132A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZSCAN21 |
| Target Synonyms | ZNF38; Zipro1; NY-REN-21; ZSCAN21 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, 293T, MCF7, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-280 of human ZSCAN21 (NP_666019.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICA | Uniprot ID | Q9Y5A6 |
Uniprot Id
Q9Y5A6
Target Species
Human
Target Name
ZSCAN21
Target Full Name
Zinc finger and SCAN domain-containing protein 21
Target Function
Strong transcriptional activator. Plays an important role in spermatogenesis; essential for the progression of meiotic prophase I in spermatocytes.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Research Area
Transcription
Target Synonyms
DKFZp434L134; DKFZp686H10254; KOX25; NY REN 21; NYREN21; Renal carcinoma antigen NY REN 21; Renal carcinoma antigen NY-REN-21; Zfp-38; ZFP38; zinc finger and SCAN domain containing 21; Zinc finger and SCAN domain containing protein 21; Zinc finger and SCAN domain-containing protein 21; zinc finger protein 38 (KOX 25); Zinc finger protein 38 homolog; zinc finger protein NY REN 21 antigen; Zipro1; ZNF38; ZSC21_HUMAN; ZSCAN21
Target Background
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
