Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM7A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 21-120 of mouse KDM7A (NP_001028602.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KDM7A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 21-120 of mouse KDM7A (NP_001028602.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09086A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM7A |
| Target Synonyms | Jhdm1d; mKIAA1718; A630082K20Rik; KDM7A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, BT-474, Mouse brain, Mouse spleen, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 21-120 of mouse KDM7A (NP_001028602.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | GSVSAPGRASAPPPPPPVYCVCRQPYDVNRFMIECDVCKDWFHGSCVGVEEHHAVDIDLYHCPDCAALHGSSLMKKRRNWHRHDYTEVDDGSKPVQAGTR | Uniprot ID | Q3UWM4 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
