Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIWIL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of mouse PIWIL1 (NP_067286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PIWIL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of mouse PIWIL1 (NP_067286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12576A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIWIL1 |
| Target Synonyms | MIWI; PIWIL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of mouse PIWIL1 (NP_067286.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MTGRARARARGRARGQETVQHVGAAASQQPGYIPPRPQQSPTEGDLVGRGRQRGMVVGATSKSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGR | Uniprot ID | Q9JMB7 |
Uniprot Id
Q9JMB7
Target Synonyms
MIWI; PIWIL1
Target Background
Enables several functions, including RNA binding activity; mRNA cap binding complex binding activity; and polysome binding activity. Involved in negative regulation of transposition; piRNA metabolic process; and spermatogenesis, exchange of chromosomal proteins. Located in chromatoid body; dense body; and nucleus. Is expressed in genitourinary system. Orthologous to human PIWIL1 (piwi like RNA-mediated gene silencing 1).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
