Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
| Cat.No | ACP01443 | Target Name | HPRT1 |
|---|---|---|---|
| Form | Liquid or Lyophilized powder | Expression System | E.coli |
| Expression Range | MHHHHHHKWFKIQMQIRRWKNKRGGGGSGFLGPAPAPAPAPA+2-218aa | Mol Weight | 29.2 kDa |
| Protein Length | Full Length of Mature Protein | Purity | Greater than 90% as determined by SDS-PAGE. |
| Storage Buffer | 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, Liquid form: default storage buffer is Tris/PBS-based buffer, pH 8.0. |
| Target Species | Human | Uniprot ID | P00492 |
|---|
Uniprot Id
P00492
Target Species
Human
Target Name
HPRT1
Target Full Name
Hypoxanthine-guanine phosphoribosyltransferase
Target Function
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
Target Involvement
Lesch-Nyhan syndrome (LNS); Gout HPRT-related (GOUT-HPRT)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Purine/pyrimidine phosphoribosyltransferase family
Target Research Area
Metabolism
Target Synonyms
HGPRT; HGPRTase; HPRT 1; HPRT_HUMAN; HPRT1; Hypoxanthine guanine phosphoribosyltransferase ; Hypoxanthine phosphoribosyltransferase 1 (Lesch Nyhan syndrome); Hypoxanthine phosphoribosyltransferase 1; Hypoxanthine-guanine phosphoribosyltransferase
Target Background
The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
