-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Siglec1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-138 of mouse Siglec1(NP_035556.3?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Siglec1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-138 of mouse Siglec1(NP_035556.3?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08028A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIGLEC1 |
| Target Synonyms | SN; CD169; SIGLEC-1; SIGLEC1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-138 of mouse Siglec1(NP_035556.3?). | Immunogen Sequence | TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD |
|---|---|---|---|
| Uniprot ID | Q62230 |
Notification