Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SnRK2.3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SnRK2.3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07191A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SnRK2.3 |
| Target Synonyms | SNRK2-3; SRK2I; SUCROSE NONFERMENTING 1 (SNF1)-RELATED PROTEIN KINASE 2-3; sucrose nonfermenting 1(SNF1)-related protein kinase 2.3; SnRK2.3 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Inflorescence | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1). | Immunogen Sequence | DVWSCGVTLYVMLVGAYPFEDPEEPRDYRKTIQRILSVKYSIPDDIRISPECCHLISRIFVADPATRISIPEIKTHSWFLKNLPADLMNESNTGSQFQEPE |
|---|---|---|---|
| Uniprot ID | Q39193 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
