Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC47A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-550 of human SLC47A1 (NP_060712.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC47A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-550 of human SLC47A1 (NP_060712.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11418A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC47A1 |
| Target Synonyms | MATE1; SLC47A1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 460-550 of human SLC47A1 (NP_060712.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL | Uniprot ID | Q96FL8 |
Uniprot Id
Q96FL8
Target Species
Human
Target Name
SLC47A1
Target Full Name
Multidrug and toxin extrusion protein 1
Target Function
Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide (NMN), metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, ganciclovir and also the zwitterionic cephalosporin, cephalexin and cephradin. Seems to also play a role in the uptake of oxaliplatin (a new platinum anticancer agent). Able to transport paraquat (PQ or N,N-dimethyl-4-4'-bipiridinium); a widely used herbicid. Responsible for the secretion of cationic drugs across the brush border membranes.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Predominantly localized at the plasma membrane but also found in intracellular organelles.
Target Protein Families
Multi antimicrobial extrusion (MATE) (TC 2.A.66.1) family
Target Tissue Specificity
Expressed in adrenal gland, and to a lower extent in liver, skeletal muscle and kidney (especially found in luminal membranes of the urinary tubules, bile caniculi and brush border membranes).
Target Synonyms
FLJ10847; hMATE-1; hMATE1; MATE-1; MATE1; MGC6482; multidrug and toxin extrusion 1; Multidrug and toxin extrusion protein 1; S47A1_HUMAN; SLC47A1; Solute carrier family 47 member 1
Target Background
This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
