-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLEC4E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human CLEC4E (NP_055173.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLEC4E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human CLEC4E (NP_055173.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11586A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLEC4E |
| Target Synonyms | MINCLE; CLECSF9; CLEC4E | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human CLEC4E (NP_055173.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLN | Uniprot ID | Q9ULY5 |
Uniprot Id
Q9ULY5
Target Species
Human
Target Name
CLEC4E
Target Full Name
C-type lectin domain family 4 member E
Target Function
Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and fungi. The PAMPs notably include mycobacterial trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid with potent adjuvant immunomodulatory functions. Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. Also recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia and mediates macrophage activation. Through recognition of DAMPs released upon nonhomeostatic cell death, enables immune sensing of damaged self and promotes inflammatory cell infiltration into the damaged tissue.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell projection, phagocytic cup.
Target Tissue Specificity
Expressed in monocytes and macrophages.
Target Synonyms
C type lectin domain family 4 member E; C type lectin superfamily member 9; C-type (calcium dependent carbohydrate recognition domain) lectin superfamily member 9; C-type lectin domain family 4 member E; C-type lectin superfamily member 9; CLC4E_HUMAN; CLEC 4E; Clec4e; CLECSF9; Macrophage inducible C type lectin; Macrophage-inducible C-type lectin; MINCLE
Target Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Notification