-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITGA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 907-1000 of human ITGA8 (NP_003629.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITGA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 907-1000 of human ITGA8 (NP_003629.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11817A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITGA8 |
| Target Synonyms | ITGA8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, Mouse spleen, Mouse testis, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 907-1000 of human ITGA8 (NP_003629.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALASLVSFEVKKMPYTDQPAKLPEGSIVIKTSVI | Uniprot ID | P53708 |
Uniprot Id
P53708
Target Species
Human
Target Name
ITGA8
Target Full Name
Integrin alpha-8
Target Function
Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures. It recognizes the sequence R-G-D in a wide array of ligands including TNC, FN1, SPP1 TGFB1, TGFB3 and VTN. NPNT is probably its functional ligand in kidney genesis. Neuronal receptor for TNC it mediates cell-cell interactions and regulates neurite outgrowth of sensory and motor neurons.
Target Involvement
Renal hypodysplasia/aplasia 1 (RHDA1)
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell membrane.
Target Protein Families
Integrin alpha chain family
Target Tissue Specificity
Expressed in mesenchymal cells, including alveolar myofibroblasts, kidney mesangial cells and hepatic stellar cells and vascular and visceral smooth muscle (at protein level).
Target Synonyms
Integrin alpha 8; Integrin alpha-8 heavy chain; Integrin alpha-8 light chain; ITA8_HUMAN; ITGA 8; ITGA8
Target Background
Integrins are heterodimeric transmembrane receptor proteins that mediate numerous cellular processes including cell adhesion, cytoskeletal rearrangement, and activation of cell signaling pathways. Integrins are composed of alpha and beta subunits. This gene encodes the alpha 8 subunit of the heterodimeric integrin alpha8beta1 protein. The encoded protein is a single-pass type 1 membrane protein that contains multiple FG-GAP repeats. This repeat is predicted to fold into a beta propeller structure. This gene regulates the recruitment of mesenchymal cells into epithelial structures, mediates cell-cell interactions, and regulates neurite outgrowth of sensory and motor neurons. The integrin alpha8beta1 protein thus plays an important role in wound-healing and organogenesis. Mutations in this gene have been associated with renal hypodysplasia/aplasia-1 (RHDA1) and with several animal models of chronic kidney disease. Alternate splicing results in multiple transcript variants encoding distinct isoforms.
Notification