-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against ACSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-12387A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACSL1 |
| Target Synonyms | ACS1; LACS; FACL1; FACL2; LACS1; LACS2; ACSL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, Raji | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA | Uniprot ID | P33121 |
Uniprot Id
P33121
Target Species
Human
Target Name
ACSL1
Target Full Name
Long-chain-fatty-acid--CoA ligase 1
Target Function
Catalyzes the conversion of long-chain fatty acids to their active form acyl-CoAs for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate. Preferentially activates arachidonate than epoxyeicosatrienoic acids (EETs) or hydroxyeicosatrienoic acids (HETEs).
Target Subcellular Location
Mitochondrion outer membrane; Single-pass type III membrane protein. Peroxisome membrane; Single-pass type III membrane protein. Microsome membrane; Single-pass type III membrane protein. Endoplasmic reticulum membrane; Single-pass type III membrane protein.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Tissue Specificity
Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas.
Target Synonyms
ACSL1; FACL1; FACL2; LACS; LACS1; LACS2; Long-chain-fatty-acid--CoA ligase 1; Acyl-CoA synthetase 1; ACS1; Arachidonate--CoA ligase; Long-chain acyl-CoA synthetase 1; LACS 1; Long-chain acyl-CoA synthetase 2; LACS 2; Long-chain fatty acid-CoA ligase 2; Palmitoyl-CoA ligase 1; Palmitoyl-CoA ligase 2; Phytanate--CoA ligase
Target Background
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.
Notification