-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD40 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 198-277 of human CD40 (NP_001241.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD40 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 198-277 of human CD40 (NP_001241.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12486A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD40 |
| Target Synonyms | p50; Bp50; CDW40; TNFRSF5; CD40 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence within amino acids 198-277 of human CD40 (NP_001241.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ | Uniprot ID | P25942 |
Uniprot Id
P25942
Target Species
Human
Target Name
CD40
Target Full Name
Tumor necrosis factor receptor superfamily member 5
Target Function
Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
Target Involvement
Immunodeficiency with hyper-IgM 3 (HIGM3)
Target Subcellular Location
[Isoform I]: Cell membrane; Single-pass type I membrane protein.; [Isoform II]: Secreted.
Target Tissue Specificity
B-cells and in primary carcinomas.
Target Research Area
Immunology
Target Synonyms
CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40
Target Background
This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Notification