-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MMP7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MMP7 (NP_002414.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MMP7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MMP7 (NP_002414.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12729A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MMP7 |
| Target Synonyms | MMP-7; MPSL1; PUMP-1; MMP7 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, HT-29, Rat uterus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MMP7 (NP_002414.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWG | Uniprot ID | P09237 |
Uniprot Id
P09237
Target Species
Human
Target Name
MMP7
Target Full Name
Matrilysin
Target Function
Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Peptidase M10A family
Target Research Area
Developmental Biology
Target Synonyms
Matrilysin; Matrin; Matrix Metalloproteinase 7; Matrix metalloproteinase-7; MMP 7; MMP-7; MMP7; MMP7_HUMAN; MPSL1; PUMP 1; Pump 1 protease; Pump-1 protease; PUMP1; Uterine matrilysin; Uterine metalloproteinase
Target Background
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal hemopexin domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes on chromosome 11. This gene exhibits elevated expression levels in multiple human cancers.
Notification