-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSD95 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSD95 (NP_001308004.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PSD95 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSD95 (NP_001308004.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12755A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSD95 |
| Target Synonyms | MRD62; PSD95; SAP90; SAP-90 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSD95 (NP_001308004.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKII | Uniprot ID | P78352 |
Uniprot Id
P78352
Target Species
Human
Target Name
DLG4
Target Full Name
Disks large homolog 4
Target Function
Postsynaptic scaffolding protein that plays a critical role in synaptogenesis and synaptic plasticity by providing a platform for the postsynaptic clustering of crucial synaptic proteins. Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B. Also regulates AMPA-type glutamate receptor (AMPAR) immobilization at postsynaptic density keeping the channels in an activated state in the presence of glutamate and preventing synaptic depression.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cell junction, synapse, postsynaptic density. Cell junction, synapse. Cytoplasm. Cell projection, axon. Cell projection, dendritic spine. Cell projection, dendrite. Cell junction, synapse, presynapse.
Target Protein Families
MAGUK family
Target Tissue Specificity
Brain.
Target Research Area
Neuroscience
Target Synonyms
Discs large homolog 4; Disks large homolog 4; DLG 4; Dlg4; DLG4_HUMAN; FLJ97752; FLJ98574; Human post synaptic density protein 95; Post synaptic density protein 95; Postsynaptic density protein 95; PSD 95; PSD-95; PSD95; SAP 90; SAP-90; SAP90; Synapse associated protein 90; Synapse-associated protein 90; Tax interaction protein 15
Target Background
This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification