-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Granzyme B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Granzyme B (NP_004122.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Granzyme B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Granzyme B (NP_004122.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12836A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Granzyme B |
| Target Synonyms | C11; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1; Granzyme B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse large intestine, THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Granzyme B (NP_004122.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK | Uniprot ID | P10144 |
Uniprot Id
P10144
Target Species
Human
Target Name
GZMB
Target Full Name
Granzyme B
Target Function
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse. It cleaves after Asp. Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-E (GSDME), releasing the pore-forming moiety of GSDME, thereby triggering pyroptosis and target cell death. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.
Target Subcellular Location
Secreted. Cytolytic granule.
Target Protein Families
Peptidase S1 family, Granzyme subfamily
Target Research Area
Immunology
Target Synonyms
C11; Cathepsin G like 1; Cathepsin G-like 1; CCPI; CGL 1; CGL1; CSP B; CSPB; CTLA 1; CTLA-1; CTLA1; CTSGL1; Cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; Cytotoxic T lymphocyte proteinase 2; Cytotoxic T-lymphocyte proteinase 2; Fragmentin 2; Fragmentin-2; GRAB_HUMAN; Granzyme 2; Granzyme B (granzyme 2; cytotoxic T lymphocyte associated serine esterase 1); Granzyme B; Granzyme-2; GranzymeB; GRB; Gzmb; Hlp; Human lymphocyte protein; Lymphocyte protease; Protease; serine; B; SECT; T cell serine protease 1 3E; T cell serine protease 1-3E; T-cell serine protease 1-3E
Target Background
This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis.
Notification