Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VCAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VCAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12991A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VCAM1 |
| Target Synonyms | CD106; INCAM-100; VCAM1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HUVEC, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL | Uniprot ID | P19320 |
Uniprot Id
P19320
Target Species
Human
Target Name
VCAM1
Target Full Name
Vascular cell adhesion protein 1
Target Function
Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue.
Target Research Area
Cell Adhesion
Target Synonyms
CD106; CD106 Antigen; INCAM 100; INCAM-100; L1CAM; MGC99561; V-CAM 1; Vascular Cell Adhesion Molecule 1; Vascular cell adhesion protein 1; VCAM 1; VCAM-1; VCAM1; VCAM1_HUMAN
Target Background
This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
