Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 589-688 of human GRK3 (P35626) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 589-688 of human GRK3 (P35626) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13252A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRK3 |
| Target Synonyms | BARK2; ADRBK2; GRK3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 589-688 of human GRK3 (P35626). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSLCHRNSNGL | Uniprot ID | P35626 |
Uniprot Id
P35626
Target Species
Human
Target Name
GRK3
Target Full Name
G protein-coupled receptor kinase 3
Target Function
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, GPRK subfamily
Target Synonyms
ADRBK2; Adrenergic; beta; receptor kinase 2; ARBK2_HUMAN; BARK2; Beta adrenergic receptor kinase 2; Beta ARK 2; Beta-adrenergic receptor kinase 2; Beta-ARK-2; EC 2.7.11.15; G protein coupled receptor kinase 3; G-protein-coupled receptor kinase 3; GRK3
Target Background
The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
