Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCTD9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCTD9 (Q7L273) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCTD9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCTD9 (Q7L273) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13286A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCTD9 |
| Target Synonyms | BTBD27; KCTD9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, U2OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCTD9 (Q7L273). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPFIDPQTDSKPPEGLLGFHTDWLTLNVGGRYF | Uniprot ID | Q7L273 |
Uniprot Id
Q7L273
Target Species
Human
Target Name
KCTD9
Target Full Name
BTB/POZ domain-containing protein KCTD9
Target Function
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of target proteins, leading to their degradation by the proteasome.
Target Synonyms
KCTD9; BTB/POZ domain-containing protein KCTD9
Target Background
Enables cullin family protein binding activity; identical protein binding activity; and protein self-association. Predicted to be involved in intracellular signal transduction; protein homooligomerization; and protein ubiquitination.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
